SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004059141.2.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004059141.2.27298
Domain Number 1 Region: 26-142
Classification Level Classification E-value
Superfamily L domain-like 4.76e-21
Family U2A'-like 0.03
Further Details:      
 
Weak hits

Sequence:  XP_004059141.2.27298
Domain Number - Region: 496-580
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0017
Family PspA lactotransferrin-binding region 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004059141.2.27298
Sequence length 647
Comment PREDICTED: centrosomal protein of 72 kDa [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MARAGPRLVLSEEAVRAKSGLGPHRDLAELRSLSIPGTYQEKITHLGHSLMSLTGLKSLD
LSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDY
RLFVVHLLPKLQQLDDRPVRESERKASRLHFASEDSLDSKESVPASLKEGRPHHPRAKCT
EALAKQSLVMDVDDEAVLNLIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQL
VQYQCGDSGKQGRETRRSSCRGCCLEKTPWSQLCGELPPPYGAEPEASRAPGPHAYFTPH
PDSVDTEDSASSQKLDMSAEMVPGPLPAPGKCRKRRMPVGRLQTFSDQEGLGCLERTHGS
SVPEESLRRQDNSESRNGRTLSQPEALETEEQRSRGVTDTREPSPGSHLALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDGSAMVGEDVGSLALE
SKSLQSRLAEQQQQHAREMSEVTAELHRTHKELDDLRQHLDKSLEENSRLKSLLLSMKKE
VKSADTAATLNLQIAGLQTSVKRLCGEIVELKQHLEHYDKIQELTRMLQESHSSLVSTNE
HLLQELSQVRAQHRAEVEQMHWSYQELKKTMALFPHSSASHGGRQAC
Download sequence
Identical sequences G3R4Z6
ENSGGOP00000010362 ENSGGOP00000010362 XP_004059141.2.27298 XP_018869049.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]