SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004060137.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004060137.1.27298
Domain Number 1 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 198-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.82e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0006
Further Details:      
 
Domain Number 6 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 140-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-20
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 96-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000142
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 532-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000533
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 243-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000434
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004060137.1.27298
Sequence length 576
Comment PREDICTED: zinc finger protein 791 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MDSVAFEDVSVSFSQEEWALLAPSQKKLYRDVMQETFKNLASIGEKWEDPNVEDQHKNQG
RNLRSHTGERLCEGKEGSQCAENFSPNLSATKKTAGVKPYECTICGKAFMRLSSLTRHMR
SHTGYELFEKPYKCKECEKAFSYLKSFQRHERSHTGEKPYKCKQCGKTFIYHQPFQRHER
THIGEKPYECKQCGKALSCSSSLRVHERIHTGEKPYECKQCGKAFSCSSSIRVHERTHTG
EKPYACKECGKAFISHTSVLTHMITHNGDRPYKCKECGKAFIFPSFLRVHERIHTGEKPY
KCKQCGKAFRCSTSIQIHERIHTGEKPYKCKECGKSFSARPAFRVHVRVHTGEKPYKCKE
CGKAFSRISYFRIHERTHTGEKPYECKKCGKTFNYPLDLKIHKRNHTGEKPYECKECAKT
FISLENFRRHMITHTGDGPYKCRDCGKVFIFPSALRTHERTHTGEKPYECKQCGKAFSCS
SYIRIHKRTHTGEKPYECKECGKAFIYPTSFQGHMRMHTGEKPYKCKECGKAFSLHSSFQ
RHTRIHNYEKPLECKQCGKAFSVSTSLKKHMRMHNR
Download sequence
Identical sequences G3QEA6
ENSGGOP00000000598 ENSGGOP00000000598 XP_004060137.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]