SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004060436.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004060436.1.27298
Domain Number 1 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 6 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-19
Family KRAB domain (Kruppel-associated box) 0.00041
Further Details:      
 
Domain Number 8 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 9 Region: 193-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 163-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 87-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000629
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 138-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000127
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004060436.1.27298
Sequence length 642
Comment PREDICTED: zinc finger protein 14 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MDSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQG
RNRRCHMVERLCESRKGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFMHHSSLNR
HMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYRHCFRKHERTHTGVKPYECKQCGKAFIY
YQPFQRHERTHAGEKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKLCGKAFICYQSFQR
HKRTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYKCKECGKAFSFLSSFRRHKRT
HSGEKPYECKECGKAFFYSASFRAHVITHTGARPYKCKECGKAFNSSNSCRVHERTHIGE
KPYECKQCGKSFSWSISLRLHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYE
CKQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQC
GKVFIRSSSFRLHERTHTGEKPYECKLCGKTFSFSSSLREHEKIHTGNKPFECKQCGKAF
LRSSQIRLHERTHTGEKPYQCKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSS
SVRIHERSHTGEKPYECKQCGKAFISSSHFRLHERTHMGEKV
Download sequence
Identical sequences G3RRU8
ENSGGOP00000018522 XP_004060436.1.27298 ENSGGOP00000018522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]