SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004061218.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004061218.1.27298
Domain Number 1 Region: 51-108
Classification Level Classification E-value
Superfamily GLA-domain 6.39e-20
Family GLA-domain 0.00068
Further Details:      
 
Weak hits

Sequence:  XP_004061218.1.27298
Domain Number - Region: 164-173
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0458
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004061218.1.27298
Sequence length 202
Comment PREDICTED: transmembrane gamma-carboxyglutamic acid protein 2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MRGHPSLLLLYMALTTCLDTSPSGETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTP
GNLERECLEERCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVAGLAVGLTCGILL
IVLAGLGAFWYLHWRRRRGQQPCPQEAGLISLLSPLSPLGPPTPLPPPPPPPPGLPTYEQ
ALAASGVHDAPPPPYTSLRRPH
Download sequence
Identical sequences G3QH64
XP_004061218.1.27298 ENSGGOP00000001686 ENSGGOP00000001686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]