SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004061965.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004061965.1.27298
Domain Number 1 Region: 58-166
Classification Level Classification E-value
Superfamily Cystatin/monellin 6.59e-33
Family Cystatins 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004061965.1.27298
Sequence length 167
Comment PREDICTED: cystatin-F [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MLPEKALHSHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSGVKPGF
PKTIKTNDPGVLQAARYSVEKFNNCTNDKFLFRESRITRALVQIVKGLKYMLEVEIGRTT
CKKNQHPRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Download sequence
Identical sequences ENSGGOP00000001259 XP_004061965.1.27298 ENSGGOP00000001259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]