SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004062238.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004062238.1.27298
Domain Number 1 Region: 40-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.45e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 161-259
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000432
Family Glutathione S-transferase (GST), C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004062238.1.27298
Sequence length 309
Comment PREDICTED: ganglioside-induced differentiation-associated protein 1-like 1 isoform X2 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGGHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVL
DQIEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNL
QSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFA
YWYLKKKYI
Download sequence
Identical sequences B7Z1I3
ENSMMUP00000003798 NP_001243668.1.87134 NP_001243668.1.92137 XP_004062238.1.27298 XP_011853044.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]