SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004063555.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004063555.1.27298
Domain Number 1 Region: 41-138
Classification Level Classification E-value
Superfamily SH2 domain 4.43e-29
Family SH2 domain 0.00000463
Further Details:      
 
Domain Number 2 Region: 268-329
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.0000371
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000103
Family SH3-domain 0.0004
Further Details:      
 
Weak hits

Sequence:  XP_004063555.1.27298
Domain Number - Region: 190-227
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000523
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004063555.1.27298
Sequence length 330
Comment PREDICTED: GRB2-related adapter protein 2 isoform X1 [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIRFPEWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWVRALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Download sequence
Identical sequences G3QGK0
XP_004063555.1.27298 XP_004063556.1.27298 ENSGGOP00000001459 ENSGGOP00000001459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]