SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004065070.1.27298 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004065070.1.27298
Domain Number 1 Region: 380-572
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-47
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 134-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-37
Family Voltage-gated potassium channels 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004065070.1.27298
Sequence length 664
Comment PREDICTED: cyclic nucleotide-gated olfactory channel [Gorilla gorilla gorilla]; AA=GCF_000151905.2; RF=representative genome; TAX=9595; STAX=9593; NAME=Gorilla gorilla gorilla; AL=Chromosome; RT=Major
Sequence
MTEKTNGVKSSPANNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQ
QGRSGFRRIVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQQGDGKGDKDGE
DKGTKKKFELFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDY
VSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDI
HSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIRWFDYLWTNK
KTVDEREILKNLPAKLRAEIAINVHLSTLKKVHIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAA
ADKP
Download sequence
Identical sequences G3RAW1
ENSGGOP00000012593 XP_004065070.1.27298 ENSGGOP00000012593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]