SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004066864.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004066864.1.28442
Domain Number 1 Region: 133-272
Classification Level Classification E-value
Superfamily ISP domain 3.45e-38
Family Rieske iron-sulfur protein (ISP) 0.00000173
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 4.8e-25
Family ISP transmembrane anchor 0.0000743
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 8.17e-20
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004066864.1.28442
Sequence length 273
Comment cytochrome b-c1 complex subunit Rieske, mitochondrial [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MMSLAARSGAFSPYLQATAFTVAGPLKALVPGVVLKTDKVLLDTKKPFLCRESLRGQSPL
TGPAVTVSINGRAGVRFAHTDIKVPDFSDYRRPEVLDPHKPSTESSESRRAFSYLLTGAT
AVVSVYAAKTVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTE
KEISAEEAVSLAELRDPQEDKDRVIKPKWVIVIGVCTHLGCVPISNAGDYGGYYCPCHGS
HYDASGRIRKGPAPLNLEVPYYEFPDDDTVVVG
Download sequence
Identical sequences H2L4T0
8090.ENSORLP00000000780 ENSORLP00000000780 ENSORLP00000000780 XP_004066864.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]