SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004079022.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004079022.1.28442
Domain Number 1 Region: 541-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000615
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 57-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 119-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000013
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 497-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000362
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004079022.1.28442
Sequence length 588
Comment complement component C8 beta chain [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MSSEAGQVRKLISPSCLLCVTLILQLLSKVSHITASDVDSGVRHARAVVNPVVVQPVDCV
LSEWSAWSPCDVCQKKRYRFAKLQQPSQFGGEPCKFHGREEEACAVSARYTCDSVPLCEG
FLCTHTGRCVHRTLQCNGEDDCGDMSDEVGCKKVSKPCREEAEEYWGIENLAKGINVLNS
DLEGVVLDNRYYAGSCLPHYIQDVPFRKPYNLQQYTLQTKGSYDFTLQSFESYSDFMQYT
MSERSTQVSFSLGFGVPGVFNFGFNFKDSKYSKSVSQIRRASSKTNSFIRAKAELELAQY
ILKSEDLVLHPEFLRRLRSLPQSYVYGEYRQIYRDFGTHYITEAALGGDFEHTIILNKEK
LEKSDYSLEEYKKCVQVGFNVGANIYGVYVSGGVEGGSCDGLLNEMGESTKKGSMVEDFV
AVVRGGSSESITALLSKKLPSPQLMRLWGEGVRYNPDFIRMTTRPLYELVVSRDFTYRDT
LKRNLKRALSEHLAESSSCRCAPCHNNGVAVLKGTRCECVCPVGYTGRSCEVTQRQKEIA
IDGSWSCWGAWSSCGGGKKSRTRQCNNPAPSNGGIECWGPQEESTDCF
Download sequence
Identical sequences H2M1Q0
8090.ENSORLP00000012334 ENSORLP00000012334 XP_004079022.1.28442 ENSORLP00000012334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]