SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004081809.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004081809.1.28442
Domain Number 1 Region: 322-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 355-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000188
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004081809.1.28442
Sequence length 439
Comment transcription factor Sp9 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MATSILGEEPRFGTTPLAMLAATCNKIGNTSPLTTLPDSSAFSKGGFHPWKRSSSSCNLG
SSLPGFTVSTSRASTGLTPTSGTGNSAFCLASTSPTSSAFSTEYSGLFSNSASVTTQESG
QSAFISKVHTSAETLYPRVGMAHPYESWYKSGFHSTISGEVANGASSWWDVHTNPGSWLD
VQNPAGTLQTSLHSGTPQAIHSQLSGYNPDFSSLTHSAFSSTGISPSASHLLSTSQHLLT
QDGFKTVIPTYTDASAANAMISGGSSGISSSSRSSRRYSGRATCDCPNCQEAERLGPAGA
SLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLR
THTGEKRFACPVCNKRFMRSDHLSKHIKTHTAGGGGKKGSDSDTDTSNLETPRSESPELI
LEGVNPRISVKDPSPHDEP
Download sequence
Identical sequences H2MSX7
ENSORLP00000021870 XP_004081809.1.28442 8090.ENSORLP00000021870 ENSORLP00000021870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]