SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004082307.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004082307.1.28442
Domain Number 1 Region: 51-192
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000707
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004082307.1.28442
Sequence length 198
Comment integrin beta-1-binding protein 1 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MFRKVKKRHSSSSSQSSEISTKSKSVDSSFGGLSRSSTVASLDTDSNKSSGNSTSETCAE
FRVKYVGSIENLEFEMSRSLQEPLDLINYIDAAQQDGKLPFVPGDEEMILGVSKYGVKVA
SLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTTDAKQEECSIWVYQCSSSEQAQS
ICRVLSTSFDCALVSDKS
Download sequence
Identical sequences H2MJZ7
ENSORLP00000019001 XP_004082307.1.28442 XP_011488631.1.28442 8090.ENSORLP00000019001 ENSORLP00000019001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]