SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004083848.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004083848.1.28442
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily POZ domain 2.75e-24
Family BTB/POZ domain 0.0061
Further Details:      
 
Domain Number 2 Region: 341-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000522
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004083848.1.28442
Sequence length 441
Comment zinc finger and BTB domain-containing protein 25 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MEVSSHSLFLLQQLNVQREFGFLCDCTVAIGNVYFKAHRAVLAAFSNYFKMIFIHQSSEC
IKIQPTDIQPDVFSYLLHIMYTGMCPKQPVDQSRLQEGIKFLHAYQLCRKPGEATADAAA
DAVRMSNLYGIQISSQLANKGVPGVPKATTVSRGTPEDGSSMDRGVRSHSQLSLAVGLEG
VHSDPQALRNICSVASGDDSDISARIKQECVEEEDGEGREGTVVGSPGQGCSPSQGPLAE
PKEHALVLLCPRCGERCSSPEGLQEHLFSHALNPARLIEGLSQGGELDAGVEEGPPGAQE
QLDAGCLEEALRQSQALANQLAAELRRSRGGGGSNSPAPTTLHSRKRKIACAVCSLRFTH
KSQLQEHMYTHTGKPGRYHRYGRLCSQLFQSSTHFCEGGTDAGGASALSEDANRDAQDNG
SSCYSLDSEVSQESVDGVPVE
Download sequence
Identical sequences H2MLV5
ENSORLP00000019690 8090.ENSORLP00000019690 ENSORLP00000019690 XP_004083848.1.28442 XP_020570451.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]