SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004086444.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004086444.1.28442
Domain Number 1 Region: 85-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000653
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  XP_004086444.1.28442
Domain Number - Region: 22-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004086444.1.28442
Sequence length 401
Comment zinc finger protein PLAGL2-like [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MFHQQNPLKGQLDNSLSTDKEFFYCHSCGKQYNTQIGYRRHLVAFHSTSAGKPCPEDFPD
LLENVNHLGDMPPTPEGSINTPVRERKYSCERCERRFYTRKDVRRHAVVHTGRRDFLCPR
CTQRFGRRDHLTRHLKKSHAQESSLMSQCASDPPLTPAKEESGLLPPDGGAVSKDSLEVF
PRDICSPYPLVSPVPGMGHTHMQGSLSAGMGVGPSQVQHQLQPPSAPQQQSLNNISRYQH
GFTTYPRSDMDSFLLDLQSAPPPQMNAVNSSTSTSPQRETVVGVTAGGDTHLMPCSPNIS
TAELSCSNMELGPLLGFLPFSLPPYSPHMGMGGLVMSYPPAATTSSSSSSSSTVLSGQAP
GTFSFFQPPQAHVPQGPAVHSHSQLPQPSSCLSHYYQAFQQ
Download sequence
Identical sequences H2N0Q2
ENSORLP00000024968 ENSORLP00000024968 XP_004086444.1.28442 8090.ENSORLP00000024968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]