SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004087147.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004087147.1.23891
Domain Number 1 Region: 27-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.68e-30
Family MHC antigen-recognition domain 0.00000844
Further Details:      
 
Domain Number 2 Region: 113-207
Classification Level Classification E-value
Superfamily Immunoglobulin 7e-24
Family C1 set domains (antibody constant domain-like) 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004087147.1.23891
Sequence length 255
Comment PREDICTED: HLA class II histocompatibility antigen, DQ alpha 1 chain isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MILNKALMLGALALTTVMSPCGGEDIVADHVASCGVNLYQSYGLSGQYTHEFDGDEQFYV
DLGRKETAWRWPELSNFGGFDPQGALRNLAVVKHNLDIMIKRFNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLGEPLLKHWEPEIPAPMSELTETVVCALGLSAGLVGIVVGTVFII
QGLRSVGASRHQGPL
Download sequence
Identical sequences A0A2I3GGW8
XP_003272199.1.23891 XP_004087147.1.23891 ENSNLEP00000008165 ENSNLEP00000008165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]