SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004087473.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004087473.1.23891
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily SRP19 1.19e-25
Family SRP19 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004087473.1.23891
Sequence length 120
Comment PREDICTED: signal recognition particle 19 kDa protein isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKKNKMYSREWNRDVQYRGRVRV
QLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences A0A087WYR0 A0A2I3GY22 A0A2I3THT8 A0A2J8XEP7
gi|323510698|ref|NP_001191123.1| NP_001191123.1.87134 NP_001191123.1.92137 XP_004087473.1.23891 ENSP00000482018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]