SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004089623.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004089623.1.23891
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 8 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-19
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 644-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000181
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 12 Region: 95-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000323
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004089623.1.23891
Sequence length 696
Comment PREDICTED: zinc finger protein 607 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MACGSITFGDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLAGHSISKPDLITLLE
QGKEPWMIVREETRGECTDLDSRCEIISDGKMKLYRKHSSVTLHQRIHNGQKPYECKECQ
KAFSHLTELMVHQTIHTSEEPDQREEFGKAFSHLTDLREHQKIYAREKPYECEECGKVFS
YPANLAQHGKVHVEKPYECTECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRL
SRHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHK
RIHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSGHQLSAPHTFES
VEKPYKCEECGKAFSVHGRLTRHQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKP
YKCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQ
ECGKGFSYSHKLTIHHRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGK
SFRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDQTHAGEKSYECKECGETFSH
ASHLIIHERIHTGDKPYECKRCGKAFRCASYLVRHERIHADGNPYMCEECGKAFNSSHEL
SIHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences XP_004089623.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]