SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004090016.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004090016.1.23891
Domain Number 1 Region: 43-137
Classification Level Classification E-value
Superfamily Immunoglobulin 3.48e-16
Family V set domains (antibody variable domain-like) 0.0049
Further Details:      
 
Domain Number 2 Region: 158-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000166
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004090016.1.23891
Sequence length 278
Comment PREDICTED: V-set domain-containing T-cell activation inhibitor 1 isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKPLTSRIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKL
SDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTD
AGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQ
VDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESE
IKRRSHLQLLNSKASLCVSSFFAISWALLPLTPYLMLK
Download sequence
Identical sequences XP_004090016.1.23891 ENSNLEP00000006368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]