SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004135823.1.97903 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004135823.1.97903
Domain Number 1 Region: 68-158
Classification Level Classification E-value
Superfamily BRCT domain 1.45e-23
Family DNA-repair protein XRCC1 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004135823.1.97903
Sequence length 372
Comment PREDICTED: DNA-repair protein XRCC1 [Cucumis sativus]; AA=GCF_000004075.2; RF=representative genome; TAX=3659; STAX=3659; NAME=Cucumis sativus; cultivar=9930; AL=Chromosome; RT=Major
Sequence
MSNSKANEGGGSAKRSLPSWMSGKDDGSTSRGKKPNSSASVGNDLMVEAEEPKQEKGNGE
GPVSSSLHHDFSRLLEGVVFVLSGFVNPERSILRSQALEMGAQYKPDWNSDCTLLICAFP
NTPKFRQVESDCGTIVSKEWISECYAQKRLVDIESYLLYAGKPWRRCDLSREATQDIPSP
SKKPQRVVEKTSHLKPHEPEIAQSRRSNFSRDCFSPSKLKKWAIDDYHKTLSWLESQEEK
PDPSEIKKIAAEGILTCLQDAIDSLHQNQDINQMTEEWKFVPQVVEELAKLSNKKESISK
EELCRQATDSKSIYEVELNSLLESSPERKKKRIVKKESKNGHETKEYDSDDTIEMTEEEI
DVAFHKVVCKNS
Download sequence
Identical sequences A0A0A0KAC1
XP_004135823.1.97903 Cucsa.004460.1|PACid:16951008 Cucsa.004460.2|PACid:16951009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]