SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004183557.1.21224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004183557.1.21224
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.29e-40
Family FCH domain 0.008
Further Details:      
 
Domain Number 2 Region: 309-364
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-17
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004183557.1.21224
Sequence length 366
Comment hypothetical protein EIN_064260 [Entamoeba invadens IP1]; AA=GCF_000330505.1; RF=representative genome; TAX=370355; STAX=33085; NAME=Entamoeba invadens IP1; strain=IP1; AL=Scaffold; RT=Major
Sequence
MNFTTSLKGNLEFVFKHSNHNIRFCGEVADLLDKLRSSRKEYCKSITKISQEFQKKLEDD
ALYGTTKEAVCQLLTSVLEEADGQMKTVEVLTNSIEEFKNKTKEIEKAAKGVRQDAETRT
KDVEKCKDATKKEKDKFVKCHKDVTSMLSDIEKSKTANAPEKKIKSLEEKRDHLKEKEEE
QNKVYVTSVETTNKRIKHFFDVDQIEILELYNKFEVNYLEQMKEILKNFSESLASIPVIV
KESMEKYNDKASHINSSEDVVTFCKIHKTSCRTPTYVPVIDADGLIIKQEGALNERRNDD
PEGMERVFLTCTVVHDFIAEGPEEMNVKKGDTIIVSEKHENGWWYATNKENATVGFVPET
FVKDVN
Download sequence
Identical sequences A0A0A1TV83 S0B210
XP_004183557.1.21224 jCVI|EIN_039780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]