SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004185937.1.21224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004185937.1.21224
Domain Number 1 Region: 20-216
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.23e-23
Family Arfaptin, Rac-binding fragment 0.0097
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-23
Family SH3-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004185937.1.21224
Sequence length 293
Comment hypothetical protein EIN_162250 [Entamoeba invadens IP1]; AA=GCF_000330505.1; RF=representative genome; TAX=370355; STAX=33085; NAME=Entamoeba invadens IP1; strain=IP1; AL=Scaffold; RT=Major
Sequence
MTETVGTKFNRKMFQLKTHLHMKEKTHDTDLRTAKARVTENKKLYKQILHCAEALPVQAF
TPVETMRQTAEMINDKKVVEILESVGKIGFETIEQDLVVPLREHIEHYDDVQRRIDDCHK
TRIDMDRHKEKLDNLLKKTNKQGRVSEFQIKYDAECDRYSKMRSEILEETRYLDEERDTI
ARPIMSSLLLCYTLYLDTVNDKWLQIRDVLKEVPPNFKFSKEENKIVPMMVTKEQTKPLC
TVQSLYDFDATQENELSLTEGDVVDVLEENGDWWYGEINGKRGYFPSNYVRTI
Download sequence
Identical sequences A0A0A1TYJ5
jCVI|EIN_099530 XP_004185937.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]