SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004230782.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004230782.1.44838
Domain Number 1 Region: 120-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-22
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004230782.1.44838
Sequence length 336
Comment PREDICTED: B3 domain-containing protein At5g42700 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MEERNFIPVKRRTKSCKKRQQQVEPHTLKSTSHSSASTSTQTDPLSMIKTVQLDRKKMIP
KKPRSVKSKAKQVKSNHPRKAESHSIKRKGSKRTRINDLYDDVEAKYSVMERAEKVLSSL
PDEFPSFAKCMLPSNVAHGFWLHLPKSFCNMHLPSSDTTVILVDEWGNEYKTSYLLERNG
LSAGWRGFSISHRLLKGDLLIFRLIEPCKMKVYIVRVNGQEVVDAALCLMYWETLNTSTE
LDLVRKDKRKRKKAKHLAEPFFVDLSKPKEHVQNDSHCTVDLNVSPSEHRSENNSEDLDS
EVLQGSDVTNRLQSNEICCSETSFLHDNPHKSVDCR
Download sequence
Identical sequences K4B329
XP_004230782.1.44838 Solyc01g108130.2.1 Solyc01g108130.2.1 Sopim01g108130.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]