SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004235706.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004235706.1.44838
Domain Number 1 Region: 311-434
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-28
Family Ran-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004235706.1.44838
Sequence length 449
Comment PREDICTED: nuclear pore complex protein NUP50A [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MGDAENSLQPSKKRAAIKELSRDNPGLDDDENEAELETGSFKKASEEVMASRRIVKVRRS
QTTSSTATPSANPFAAIRLVPPTESSIPSTVITSEVESGITSSGKPEDKNDIGEATRKET
NDVCKEELKESDQISKPSEGNVDESNVVKEKVETPNEADKPESAEEKVADDEKVQAETKE
GTVVEKSENDSKKDVEVEKTKNEEQNDAGGEKSEKGAETASFSSFQQLSSGQNAFTGFSG
TGFSSTTFSFGGISKEGSSLGFGSESGAGSLFGAKSDQSPFGLNLPTNGSTSLFGNSGSS
LVNKSEGTGFPSKEEVTVETGEENEKPVFAADSVLFEYLNGGWKERGKGELKVNVSTTGE
GKGRLVMRTKGNYRLILNASLFPEMKLANMDKRGVTFACLNSAADGKGLSTIALKFKDAS
IVEDFRAAVVEHKGTTTGSLKTPENSPKA
Download sequence
Identical sequences K4BMH7
Sopim03g120280.0.1 Solyc03g120280.1.1 XP_004235706.1.44838 Solyc03g120280.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]