SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004236767.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004236767.1.44838
Domain Number - Region: 447-568
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0068
Family IMD domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004236767.1.44838
Sequence length 715
Comment PREDICTED: coiled-coil domain-containing protein 18 isoform X2 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MSWLRSAMNKAVEVGNSNLTRTVRNYADSVGHAVAEGAKILQDRIGNRNFKSFKQTVQRL
EEASISCKGPERVQLMKRWLAALKAIDNMSEVSVEDKEKNNEQQHPSEEVRKQPLVLYYD
SEMGGEPLNFRDVFLYSKGLEGMVICMILEAPNEEEISLLLELFELCLTGGKAVHSAIIS
SIQDLSNAFSNYQDEVLVKREELLQFAESAITGLKSNADLGRIDAEVSTLNKQLDEIKAV
KDASGDHETISKETAASIEALKVALAHIRVCSRLEGLLLKKKSLKYGDSPEVHSQKVDKL
KLLSESLVRSANKAEKEISDDRIQKEEALKFRVAKTSEVGEIEKELAAEISALEKQRNEI
EAQLKQVNISLAAASARLHNAREERDQFYDANDQIVAHLKTREGELSKTIGSCRVEEHVV
SSWIKFLEDAWVLQSSYTETKDKEAKVELEKHEDYFVNLVLQLLSDYEKELRPSIDRIRK
YVENLKSLGEGSAKEAGLSSGESKALSPRKSLELEYLDYEAKIITTFSVVDNMMEQFYAQ
HGKVSRKDDPKIKGLFENIEKLREEFESIERPELEMEIPDAPTQEGDASSHNIPDENKSD
PARKATEAPETGTNEENKPPSTKAENVSNAAPNKVPENVSSSARKTIEAPTAGAKEEKKP
AATSAEQMYEAELAKLESESGNINQDFTAEEIGGWEFDELENELNSGTRAIPEKR
Download sequence
Identical sequences K4BPH6
Solyc04g010220.2.1 Sopim04g010220.0.1 XP_004236767.1.44838 Solyc04g010220.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]