SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004240886.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004240886.1.44838
Domain Number 1 Region: 105-230
Classification Level Classification E-value
Superfamily PX domain 4.06e-29
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 305-360,388-531
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000181
Family Arfaptin, Rac-binding fragment 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004240886.1.44838
Sequence length 541
Comment PREDICTED: sorting nexin 2A [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MMGYENQESHLYASKKEMESLVLDDDSPNGTSHPFSDPLSSSSSLPFAEIPTDQGQTPNS
SFNSILEPPSYAEAIFRSFDADHSSPQLNGAHDHSIASPSSLPSSDDFLTITVSDPQKEQ
ELSNSLVPGGTAYVTYLITTRTNLPEFDGTEFSVRRRFRDVVTLSDRLAESYRGFFIPIR
PDKSVVESQVMQKQEFVEQRRAALEKYLRRLAAHPVIRRSEELRMFLEANGKLPLVRTTD
VASRMLDGAVQLPKQIFGETAGGMVDANEVAQPAKGGRDLLRIFRELKQSVSNDWGGVKP
PVVEEDKELLEKKQKLHDFEQQLSNVSQQAEALVKSQQDIGETMGQMGLAFVKLTKFETE
RAVYDSQRTRAADMKNVATASVKASRLYRELNAQTVKHLDKLHEYLGVMLAVNNAFSDRS
SALLTVQTLLSELSSLNSRIEKLEAAASKIFGGDRARIRKIEELKETHRETEDAKSSAVR
EYERIKENNKSELARFEKERRDDFLGMLRGFVVNQAGYAEKMANVWETVADETKGYAKHG
S
Download sequence
Identical sequences K4C5J9
Solyc06g050550.2.1 XP_004240886.1.44838 Solyc06g050550.2.1 Sopim06g050550.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]