SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004242725.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004242725.1.44838
Domain Number 1 Region: 37-143,509-585
Classification Level Classification E-value
Superfamily TPR-like 4.69e-27
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 317-411
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.01e-16
Family PB1 domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004242725.1.44838
Sequence length 778
Comment PREDICTED: uncharacterized protein LOC101256392 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MGKESWTKSKKIGGKSGESSSPRAFDKDTAVFIAMSKELKDEGNKLFQKRDYEGAMLKYD
KAIKLLPRNHIDVSYLRSNIAACYMQMGLSEYPRAIHECNLALEVTPKYSKALLKRARCY
EALNRLDLAQRDVNRVLEMEPNNLMATEIAERVKTTIEERGIGVNDIPVDLIPVPEYVEP
TFVSSHSKSSKEKALKKKIKKVEEKMVNGKAEEKEFDAGVDLKQTDNRNEERNTEDQNEN
TDKDQTKEEKVDDKTEGNKAENKTNRKKAKDKSKEKKNKDKIEVNKVKDRFEENKDEDNE
ERKTEDKLVVEEIISHTTEEEPKRTVKLVFGDDIRWAQVPVDCSILTLREIIGDRFPSLK
AVLIKYRDQEGDLVTVTTNEELRWAEASVGHGSIRFYIVEVSPEQDPFYEKIKGVEDDHK
YNARHDKIVENGNVETSKELHNGPVCINDWIFQFSNLFKNYVGFESDDYLDLHEVGMKLY
SEALEEAITSEEAQYLFSTAGETFQEMAALALFNWGNVHMSRARKRVYLKEDSSGESLLA
QIKIAYDWALKEYSKAGERYEEALNIKPNFYEGILALGQQQFEQAKLSWYYTISTGVNLD
SWPSTEVLQLYNSAEENMERGMQMWEEAEEQRLNELSSTNKLQKMKSENLFKGISADEAS
EQAANMMSQINLLWGTMLYERSLMEFKLGLPLWQESLEVAVEKFELAGASPTDIAVMIKN
HCSNSTATEGLGFNIDEIVQAWNEMYEAKRWERGVPSFRLEPLLRRRVSKLYHALELA
Download sequence
Identical sequences K4CBK9
Solyc07g007390.2.1 XP_004242725.1.44838 Solyc07g007390.2.1 Sopim07g007390.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]