SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004243692.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004243692.1.44838
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.76e-43
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1012-1089
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000177
Family PB1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004243692.1.44838
Sequence length 1137
Comment PREDICTED: auxin response factor 7 isoform X1 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MKAPSNGYLPNSGEGERKLMNSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TDGIPSYPNLPSKLICMLHNVTLHADTETDEVYAQMTLQPVNKYDQEALLLSEMGLKQNR
QPAEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYAMQPPAQELMARDLHDQTWTFRH
IYRGQPKRHLLTTGWSVFISSKRLCAGDSVLFIRDEKSQLLLGIKRTNRQQPALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYAQVSLGMRFRMMF
ETEESGVRRYMGTITGVSDLDPIRWKSSQWRNLQVGWDESTAGERPSRVSIWDIEPVVTP
FYICPPPFFRPKFPKQPSFPGDESDIENVLKRGMPWINDELGLKDAQNSIFPGLSLVQWM
SMQQNNHVPVAQSGLPSVLHSNIGSDDHSKLLNFQSPALATPGLQFNKPNQLNQPFGQIQ
QPPLAWTQEQQQSLQSPVSAQQQQQQQHTLQQQQQQQQHTLQQQQQQRHTLQQQQQQQTL
QQQQQQQQQQHTLQQQQQQQHTLQHQQQHTLQQPQQHMLQQQPQFHQQAQQQLQQQQRPS
QQQQLTGNSSPVNRCVSPNQIPNQTFPQAAVYGQLQQQQVLSASTQSQQNVPVSRNSFPS
TSLAQDFQFQQQMEQQSNLLQKSQQQQTIPQQAPLQLLQQSLMQRSQVQPSSQQSLTEQQ
LQLQLLNKLQQQQQQQQAQLLSPVSSTLEPRMPQQQQNRQPQELQFAHQQLSSNIVTTVT
HLQSTHHAFNQLQNHHKSPITIKALSGGTEGDAPSCSTSPSTNNFQVSPPNFLTRNQGQA
ILVDESVVDPSQEQNKSECRIKHELVFSKGSELSKYKGNNTENLEAASSTTSYGLDSSGF
NFSLPALCVDGDVQSHSRNILPSAANNIDGLNPDALLSRDYDSGKDIQNLFSPFGNAPRD
IETELSDAGINSQQFGVPNMSYKPRCANDLAVNDNGILNNNAWTNQTQRMRTYTKVQKRG
SVGRTIDVTRYIGYDELRHDLARMFGIEGQLEDPQRTEWKLVYVDHENDILLVGDDPWEE
FVSCVQSIKILSCAEVQQMSLNGDLGNVPVPNQASSGTDSGNAWKGHYDDNSAASFN
Download sequence
Identical sequences K4CE89
Solyc07g042260.2.1 Solyc07g042260.2.1 XP_004243692.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]