SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004256385.1.21224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004256385.1.21224
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.68e-42
Family ROO N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004256385.1.21224
Sequence length 298
Comment type A flavoprotein fprA, putative, partial [Entamoeba invadens IP1]; AA=GCF_000330505.1; RF=representative genome; TAX=370355; STAX=33085; NAME=Entamoeba invadens IP1; strain=IP1; AL=Scaffold; RT=Major
Sequence
MPFLPLEVVPKLHWVGVMDYDLRVFDIIMTTPFGTSYNSFLLQTAKGNVLFETCKENFAA
ECLERIEHVIGKEGKIDYIVLNHTEPDHSGSLVHILAKYPEATVIATPAALNNVKYIGHI
KEDTKTLSAPKIKTLDLGDIHLKFIIQPFLHWPDTMMTVIEELKVLVTCDVFGGHCADDR
VFNDKMMDRIADMDEAYKHYFDCIFGPFKPYVLKGINLIETQMGFPVEELKAVCCSHGPV
LRTNIKENIERYRQWAQPQVLKNKVVIAYGSAYGYTKHMAEKIAEGVKSVGVEVSIHD
Download sequence
Identical sequences A0A0A1UBK7
jCVI|EIN_312270 XP_004256385.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]