SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004267944.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004267944.1.21590
Domain Number 1 Region: 2206-2300
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-28
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1470-1518,1596-1710
Classification Level Classification E-value
Superfamily FAS1 domain 2.62e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1711-1865
Classification Level Classification E-value
Superfamily FAS1 domain 7.46e-25
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 962-1119
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-23
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 6 Region: 386-498
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-20
Family FAS1 domain 0.0051
Further Details:      
 
Domain Number 7 Region: 2297-2460
Classification Level Classification E-value
Superfamily FAS1 domain 4.05e-17
Family FAS1 domain 0.0077
Further Details:      
 
Domain Number 8 Region: 1128-1251
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000497
Family FAS1 domain 0.0077
Further Details:      
 
Domain Number 9 Region: 1542-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000191
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004267944.1.21590
Sequence length 2569
Comment PREDICTED: stabilin-1 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MAGPRDHLLLCLLVLCLAGFSFIGGQKVQSRRCDMKTRFVTHIPCTPCPAIKKRVCPSGW
LREFPEKISQDCRYEVQLGDSLLSVSGCSVECSKDVVQKACCPGYWGSQCYECPGGAETP
CNSHGTCLDGIDRNGTCVCQENFSGSACQECRDPNRFGPDCQSVCSCVHGVCRHGPLGDG
SCLCFAGFTGPHCDQELPVCQALNCPQNSQCSAETPTCSCLPGHTQQGGECLAPDPCQPS
PCSPVAQCSVSPRGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSNSTLCLYKRPGQAS
CSCKPGLVSTNRNASAGCFAYCFPYSCDRSATCQVTPDGKTSCVCKDGEVGDGRACYGHL
LHEVQKASQTSMTLLRLRVAFAMLDQGCREILSTSGPFTVLAPSISSRTMNASLAQQLCR
QHIIAGQHMLEESGTQPTRRWWTLAGQEITVTFGRFRKYTYKYKDQPQQTFTIHKANYPA
ANGIFHVVTALRWQPPPELPEDPKRTIGQILASTEAFTRFETILENCGLPSFLDGPGPFT
VFAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYSHGQLTVEKLISKGRVLTMANQV
LAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGILLPPTILPILPKLCNEEQHKVV
AGSCVDCQALNTSMCPPNSVKLDISPEECVYIHDPTGLNVLKKGCAHYCNQTILKPGCCK
GFFGPDCVQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGDQCRQ
DCGCVHGLCDNRPGSGGVCQRGTCAPGFSGRFCNESTGICGPTEQAQQCHPHARCVNQGD
VARCLCLDGFEGDGFSCTPSNPCSRPDRGGCSENAECVPGAPGTHHCTCHKGWSGDGRVC
VAIDECELDVRGGCHADALCSYVGPGQSQCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLA
TCRAVGGGQRVCTCPPGYGGDGFSCYGDIFQELEANAHFSIFYQWIKGAGITLPADSRVT
ALVPSESAIRRLSPEDQAFWLQPRMLPQLVRAHFLQGALSEEELARLDGQSIATLSPTTR
WEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGDVLGGQGLLQQLDSVPAFR
LFRELLQRHRLVPQIEAATAYTIFVPTNHSLEAQANSSGLDLDVVRHHVILGEALSTEAL
RRGGHRNSLLGPTHWLVFYNHSGQPEVNHVPLEGPVLEAPGRSLFGLSGVLTVGSSRCLH
SHAEALREKCVNCTRKFRCTQGYQLEDTPKKSCVYRSGYSFSRGCSYTCAKKIQVPDCCP
GFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGPNCTGV
CDCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKITGPQCPQKCDPNANCVQDLAAAPACVC
AAGYSGNGIYCAVVDPCAHDHGGCSPYANCTNVAPGQRTCTCLDGYTGDGELCQEVNGCL
IHHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRTCVLLDPCSQNNGGCSPYAVCKSTGD
GQRMCTCDAVHTVGDGFTCRARVGLELLRDKHASFFSLHLLEYKELKGDGPFTIFVPHAD
LMTNLSQDELARIRANRQLVFRYHVAGCQQLRSQELLEEGYATTLSGHPLRFSEREGNIY
INDFARLVSSDHEAVNGVLHFIDRVLLPPEALHWEPDAAPIPQRNFTAAAESFGYKIFSG
LVTMAGLLPLLRDSFHRPFTMLWPTDSALQALPPDRQVWLYHKDHRDKLAAIVRGHVIRN
VEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEEDARIVQRHLPFEGGLAYGIDQ
LLEPPGLGARCDRFETRPLWLKVCSVCGLEPPCPEGSQEQGSPEGCWRYFSKFWTSPPLH
SLALRSVWARPSHWGQPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCNGH
GTCMDGMSGSGNCRCHSRFAGMACELCAPGAFGPLCQACNCTSHGHCDEGLGGSGSCFCD
EGWTGPHCEVQLELQPVCAPPCASQAVCRAGHSCECSLGYEGDGRTCTVVDLCQHGRGGC
SEHANCSQVGTVVTCTCLPDYEGDGWSCRARNPCEDGHRGGCSEHADCLSTGPNTRRCAC
HAGYVGDGLQCLEEPEPPVDRCLDQPPPCHVDAVCTDLHFQEKRAGVFHLQAPSGSYSLN
FSQAEAACGAQGAVLASLPQLSAAQQLGFHLCLVGWLANGSAAHPVVFPAADCGDGQVGV
VSLGARENLSECWDAYCYRMQDVACRCRDGFVGDGASVCNGKLLDVLATTANFSTFYGML
LGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFMDNLTLSGPDLELHASNTTFLSTNAS
QGTLLPAHSGLSLIISDMGPDNSSRAPVVPGAVVVSHVIVWDIVAFNGIIHTLASPLLAP
PQPRAVLAPEAPPVAAGAGAVVAAGVLLGLAAGALYLRARSRSAGFGFSAFQAEDDAADD
FSPWQEGTSPTLVSVPNPVFGSHDAFCEPFDDALLEDDFPDTQRILEVK
Download sequence
Identical sequences XP_004267944.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]