SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004275891.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004275891.1.21590
Domain Number 1 Region: 20-153
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-45
Family Regulator of G-protein signaling, RGS 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004275891.1.21590
Sequence length 159
Comment PREDICTED: regulator of G-protein signaling 13 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MSRRNCWICKMCRDDSKRPPSNLTLEEALQWAQSFEKLMATKYGPVVYAAYLKMEHSDEN
IKFWMACETYKKVASQRSRTSRAKKLYRTYIQPQSPREINIDSSTRETIIKNIQEPTQTC
FEEAQKIVHMHMERDSYPRFLKSEMYQKLLKTIQPNNNS
Download sequence
Identical sequences ENSTTRP00000012105 XP_004275891.1.21590 ENSTTRP00000012105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]