SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004275894.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004275894.1.21590
Domain Number 1 Region: 81-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-45
Family Regulator of G-protein signaling, RGS 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004275894.1.21590
Sequence length 235
Comment PREDICTED: regulator of G-protein signaling 18 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
METSLFFFSQLNMCEPKEKTFFKLIYGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHED
TLSSRSGQLAKETRISPEEAVIWGESFDKLLSHKDGLETFTRFLKTEFSEENIEFWIACE
DFKKSKDPQQIIHKAKAIYEKFIQNDAPQEVNLDFHTKEIITRSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYLDLIEGRPQRPTNLRRRSRSFTYNEFQDVKSDVAIWL
Download sequence
Identical sequences ENSTTRP00000002364 XP_004275894.1.21590 XP_004315894.1.83887 ENSTTRP00000002364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]