SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004281894.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_004281894.1.21590
Domain Number - Region: 406-443
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0698
Family Troponin I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004281894.1.21590
Sequence length 484
Comment PREDICTED: schwannomin-interacting protein 1 isoform X3 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MERSGQRTTTWDCDQGKQSDSDYREDGMDLGSDAGSSSSSSRASSQSNSTKVTPCSECKS
SPSPGGSLDLVSALEGYEEPFPVYQKKVIDEWAPEEDAEKEDEEERSERGYRDDRCPAQE
PGDVSARTRSGGGRGATTAMPPPVPNGNLHPHDPQDLRHNGNVVVASRPSGSRGPRRAVQ
KPQPAGGRRGGRGPAAGSLCLQPTDSGTCVPEEPPVPPMDWEALEKHLAGLQFREQEVRN
QGQARTNSTSAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQIC
FVNDSGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKK
LQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMT
IGQLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEK
MPAK
Download sequence
Identical sequences ENSTTRP00000008801 ENSTTRP00000008801 XP_004281894.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]