SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004284354.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004284354.1.21590
Domain Number 1 Region: 53-549
Classification Level Classification E-value
Superfamily Sema domain 2.35e-100
Family Sema domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1413-1538,1704-1860
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-34
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 981-1071
Classification Level Classification E-value
Superfamily E set domains 0.000000000000007
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 
Domain Number 4 Region: 890-981
Classification Level Classification E-value
Superfamily E set domains 0.000000000000108
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 5 Region: 1069-1149
Classification Level Classification E-value
Superfamily E set domains 0.000000000108
Family E-set domains of sugar-utilizing enzymes 0.079
Further Details:      
 
Domain Number 6 Region: 552-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000183
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004284354.1.21590
Sequence length 1928
Comment PREDICTED: plexin-D1 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MARRGAGGAPHSARAAAASPLPPRPPFWAPLCPPLLLLLLLLGAARIGALEIQRRFPSPT
PTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHP
RRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVHFPPAAPPAEPVTVFP
SMLNVAANHPNASTVGLVLPPAAGTGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPE
IAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPQPGAQTYA
YLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSR
LVSVFPARELLFAVFERPQGAPAARTAPAALCAFRFADVQAAIRAARTACFVEPAPDVVA
VLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKASPVFRAQGLSSVAVA
SVGNYTVVFLGTVSGRLLKINLNESMQVVSRKVVTVAYGEPVHHVMQFDPADPGYLYLMT
SHQMARVKVAACAVHTTCGDCVGAADAYCGWCALETRCTLQQDCANSSQPRFWTSASEGP
GRCPAMTVLPAEIDVHQEYPGMILQISGSLPSLSGMEMACDYGNDIHTVARVPGPAFGHQ
IAYCNLLPRNRFPPFPPNQDHVTVEMAVRVNGQNIVRASFTIYDCGRVGQVYPYTACTSC
LSAQWPCFWCAQQHSCVSNQSRCEASPNPTSPQDCPQILPSALAPMPTGSSQSIPVHLAN
AAFFQGAALECSFGREEIFEAVWVNESAVRCNQVVLHTTQKSQVFPLSLQLKGRPARFLD
SPDHMTVEVYNCAMGSPDCSQCLGREDLGHLCVWSDGCRLRGTLQPLPDTCPAPEIRAIE
PLSGPLDGGTLLTIRGRNLGRRLSDVVRGVWIGSVACEPLAGRYTVSEEIVCATGPAPGA
FSDVVTVNASKEGRSRERFSYVLPLVHSLEPAVGPKAGGTRITIHGSDLHVGSELQVLVN
DTEPCMELVRTDTSITCTVPGGALPAPVPVCVRFEHRGCVRGNLTFWYKQNPVITAISPR
RSHVSGGRTITVAGERFHMVQKVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPV
DFFLNGRAYADEAAVDEELLDPEEAQRGSRFRLDYLPDPQFSTAKREKWIKHHPGEPLTL
VIHKEQDGLGLESHEYRVKIGQVACDIQIVSERVIHCSVNESLGTAKGQLPITIQVGNFN
QTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQ
IREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPSQT
LNSPGSSLVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFA
VRDRCSLASLMTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNW
MSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRN
LNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQS
YILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLV
LPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAV
KYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSV
IAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHL
AEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMSALEANPTARRTQLQHKFEQVVALMEDN
IYECYSEA
Download sequence
Identical sequences XP_004284354.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]