SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004286493.1.21590 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004286493.1.21590
Domain Number 1 Region: 241-666
Classification Level Classification E-value
Superfamily Sema domain 3.01e-96
Family Sema domain 0.00065
Further Details:      
 
Domain Number 2 Region: 1563-1686,1883-2066
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-38
Family p120GAP domain-like 0.041
Further Details:      
 
Domain Number 3 Region: 1118-1207
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000249
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 4 Region: 1026-1121
Classification Level Classification E-value
Superfamily E set domains 0.00000000000137
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 669-721
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000144
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1206-1250,1287-1340
Classification Level Classification E-value
Superfamily E set domains 0.00000112
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004286493.1.21590
Sequence length 2102
Comment PREDICTED: plexin-B3 [Orcinus orca]; AA=GCF_000331955.2; RF=representative genome; TAX=9733; STAX=9733; NAME=Orcinus orca; AL=Scaffold; RT=Major
Sequence
MSTLLAGEVAWAASQPATPPAYTANRQGGVMPQQKEPRDLLDPSAFAAYTLSTATSPGSC
SPSPHLQPPLTQVRGRPSAMPTEAGRGQQCPALRRRAKGWARRGWASRGTQDNSGWEPLH
CGEGDWGSSGTHSWHRQLLLGPAGGPLRTMPPTAILCPSPLPRETPLLLPFAAALVSGLL
SPFPSPSTVLRRRPGKAALTHAFLPGLPQGPAMAPRPPLGACLLLVLPLLCPPLTPTWAH
RFPAPNTTLNRLALAPGRGALYVGAVNRLFQLSPALRLESVAVTGPVLDSPDCVPFREPA
ECPQARLTDNANQLLLVSGRARELVACGQVRQGVCEKRRLEDVAQLLYRAEDPGDGQFVA
ANAVGVATVGLVVPGPGQDLLLVARGLAGKLSGGVPPLTVRQLAGPQPFSSEGLGRLVVG
DLSDYNNSYVAALADARSAYFVFRRRGARAQAEYRSYVARVCLGDANLYSYVEVPLTCRG
HGLIQAASLAPGALLGAFAAGPRGAQAALCAFPLADLDATMERARRLCYTTGGRGPGGTE
EATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRQPLEAGPLLQLRNSISAVAALQA
DGHTIAFLGDVQGQLHKVFLNGTRGQVYHSQQVGPPGSAISPDLLVDSSGSHLYVLTSQQ
VDRLPVAACPQFPDCSSCLQARDPLCGWCVLQGRCTRKGQCGRAAQPNQWLWSYEDGRCL
HIQSLLPAHHPRQEQGQVTLSVPRLPTLTVDEYFHCAFGNYDSLAHVEGTHAACVTPPQD
QLPHNPPGTEHITLPLALMFEDVVVATANFSFYDCGAVQALDAAAPCSACVGSRWRCHWC
PQSSRCVYGERCPEGERTIYSAQQVDIQVRGPGACPRVEGLVGPLLVPVGWESRLALRVR
NLQHFRGLPASYHCWLELPGELQRLPASLEEVAGDAGLIHCQAQQFQPSMAQRELPVPIY
VTRGEGQRLDNARTLHVTLYDCAVGHPDCSHCQAASGSLGCLWCSHDRPTCRYGPLCPPG
AVELLCPAPSINAIEPLTGPPEGGLALTILGSNLGRDFADVQDAVSVAGRPCSPDPSLYR
ISARIVCVTSPAPNGTVGPIQVAVKSRPPGISTQHFTYQDPVLLSLSPQWGPQAGGTQLT
IHGQHLQTGGNISAFVGSQPCRIREPVCPEAIVCHTTPQASPGEAVVRVVFGRAQRTLLA
SPFHYTADPQLVAAEPSVSFRGGGRLIRVRGTGLDVVERPLLSVWLEAAEETAVAVQPRD
PTPRGSCRAPAAAPQACTQLEGGLLQCSTVCSINSSSLLLCRSPAVPDGASPRRVFFALD
NVHVDFARASGGQDFLYQPNPRLAPLSRARPYRLKPGHILDVEGEGLNLGISKEEVRVHI
GDGECLVKTLTLTHLYCEPPARAPQPTNGSRPLPQFVVQMGNVRLPLGPVQYEAEPALSA
FPVEAQAGLGLGVAVPIAAVLLLTLVYRHKSKQALRDYQKVLVQLENLEIGVGDQCRKEF
TDLMTEMTDLSSDLEASGIPFLDYRTYAERVFFPGCGSCPLQPALEGPGEEGRRAPVRQG
LMQLSNLLNSKPFLLTLIHTLEEQPSFSQRDRCLVASLLSLALHGKLEYLTDIVRTLLGD
LAAHYVQKNPKLMLRRTETMVEKLLTNWVSICLYTFLREVAGEPLYVLLRAIQYQVDKGP
VDAVTGKAKRTLNDSRLLREDVEFRTLTLTVLAGPGVGGAAAGSMVQRVPARVLDTDTIT
QVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNRWKRLNTLQH
YKVPDGATVRLIPQLHNGGAISQSPAPSCPSGQNVPALEDGEDGGVRLWHLVKVADEPEA
AKARRSSLREPERERTRAKAIPEIYLTRLLSMKGTLQKFVDDAFQAILSVNRPVPIAVKY
LFDFLDELAEKHGIEDLETLHIWKTNSLLLRFWVNTLKNPQLIFDVRVSDNVDAVLTVIA
QTFMDSCTISEHKVGRDSPVNKLLYAREIPRYKQMVERYYSDIRQSSPASYQEMNSALAE
LSGNYTSAPHCLEALQELYTHIHRYYDQIISALEEDPVGQKMQLACRLQQVAALVENKVT
DL
Download sequence
Identical sequences XP_004286493.1.21590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]