SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004312391.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004312391.1.83887
Domain Number 1 Region: 188-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.63e-78
Family Protein kinases, catalytic subunit 0.00000206
Further Details:      
 
Domain Number 2 Region: 34-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.54e-32
Family Regulator of G-protein signaling, RGS 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004312391.1.83887
Sequence length 551
Comment PREDICTED: rhodopsin kinase [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MVDMGGLDNLIANSAYLQARKSSDADSKELQRRRRTLMLPGPQSCEQLRQAPPNDFHSLC
EQQPIGRRLFRDFLATVPAYQEAVGFLEEVQSWELAEEGPAKGSTLQGLVATCAASPGHP
HPFLSPALVTKCQAATTEEERASLVELAKAEAMAFLQDQPFLEFLASPFYEKFLQWKVFE
MQPVSDKYFEEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALLEKEI
LERISSPFIVSLAYAFESKSHLCLVMSLMNGGDLKFHIYSVGERGLDMSRVVFYSAQMTC
GVLHLHSLSIVYRDLKPENVLLDDLGNCRLSDLGLAVEIRDGKPITQRAGTNGYMAPEIL
MEKASYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLKEEVRFQHDNFTEE
AKDICRLFLAKTPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYAKD
IGEIEDFSEVRGVEFDDKDTQFFQRFATGAVPIAWQEEIIETGLFAELNDPNRPAGCGEG
NSSKSGICLLL
Download sequence
Identical sequences XP_004312391.1.83887 ENSTTRP00000011413 ENSTTRP00000011413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]