SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004313379.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004313379.1.83887
Domain Number 1 Region: 196-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.98e-100
Family Phosphonoacetate hydrolase 0.021
Further Details:      
 
Domain Number 2 Region: 668-912
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.47e-25
Family DNA/RNA non-specific endonuclease 0.01
Further Details:      
 
Domain Number 3 Region: 105-150
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000103
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 151-191
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000732
Family Somatomedin B domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004313379.1.83887
Sequence length 925
Comment PREDICTED: ectonucleotide pyrophosphatase/phosphodiesterase family member 1 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MERDGCVGVGNRGGEGGRGSREGPAGNGRHLGRGSTAEAPGEPLAASSLLAPMDLGEEPL
EKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDVACVDLGNCCLDYQETCIEPERIWTCSKFRCGEKRLSRSLCSCSDDCKDKGDCCINH
GSVCRGEKSWAEETCESINGPQCPAGFEMPPTLLFSLDGFRAEYLHTWGGLLPVISKLKT
CGTYAKNLRPVYPTKTFPNHYSIVTGLYPESHGLIDNKMYDPQRNAYFALKSKEKFNPEW
YKGEPIWLTAKYQGLKTGTFFWPGSDVKINGIFPDIYKVYNGSVPFEERILAVLKWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIRALQRVDNMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYVYLSKYLGDIKNVKVIYGPAARLRPSDVPDKYYSFNYEGIAKNLSC
QEPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNTSERKYCGGGFHGSDNA
FSNMQALFIGYGPGFKHGIEVDSFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
TPKHPKEFRSLVQCPFTGAPRESLDCSCDPSILPIVDFQTQLNLTMAEEKAIKRGTLPYG
RPRVLWKNSTVCLLYQHQFVSGYSHDILMPLWTAYTVDRNASFSTEDFSNCLYQDLRIPL
RPVHKCSFYKNNTKLSYGFLSPPQLNKGSSQVYSEALLTTNTVPMYQSFQVTWHYFHGTL
LQRYAEERNGLNVVSGPVFDFDYDGHYDSLETLKQNSRIIRNQEILIPTHFFIVLTSCKD
TSQTPSQCENLDTLAFILPHRTDNSESCAHGKHESSWVEELLRRHRARITDVEHITGLSF
YQERKEPISDILKLKTHLPTFNQEG
Download sequence
Identical sequences ENSTTRP00000009401 ENSTTRP00000009401 XP_004313379.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]