SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004322601.1.83887 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004322601.1.83887
Domain Number 1 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 217-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.86e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004322601.1.83887
Sequence length 537
Comment PREDICTED: zinc finger protein 570 isoform X1 [Tursiops truncatus]; AA=GCF_001922835.1; RF=na; TAX=9739; STAX=9739; NAME=Tursiops truncatus; AL=Scaffold; RT=Major
Sequence
MAVGLLKAMYQELVTFRDVAVDFSQEEWDCLNSSQRHLYSNVMLENYRILVSLGLCFSKP
SVILLLEQGKEPWMVKRELTKDLCSDWESVCETEELTPKQDIYQVRSSQKVIETLTSCGL
EYSRLKEEWKCEGHFERQPVNQKACFKEKTIITHEEAPVDERGQEYNKTWGSFHPSTLLH
TQQIIPKEEKVHKHNTHKSFKKRLMAIKPKSIYTEKKLLKCNDCGKVFSQSSSLTLHQRI
HTGEKPYQCIECGKAFSQRSNLVQHQRIHTGEKPYECKECRKAFSQNAHLVQHLRVHTGE
KPYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYE
CNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQQC
RKAFSQIAYLAQHQRVHTGEKPYECIKCGKAFSNDSSLTQHQRVHTGEKPYECNVCGKAF
SYCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHFGESLSPPNPVNHQVL
Download sequence
Identical sequences ENSTTRP00000014410 XP_004322601.1.83887 XP_019796685.1.83887 ENSTTRP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]