SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004344969.2.32957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004344969.2.32957
Domain Number 1 Region: 529-730
Classification Level Classification E-value
Superfamily Bet v1-like 1.51e-21
Family STAR domain 0.028
Further Details:      
 
Domain Number 2 Region: 106-283
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-21
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004344969.2.32957
Sequence length 743
Comment hypothetical protein CAOG_06220 [Capsaspora owczarzaki ATCC 30864]; AA=GCF_000151315.2; RF=representative genome; TAX=595528; STAX=192875; NAME=Capsaspora owczarzaki ATCC 30864; strain=ATCC 30864; AL=Scaffold; RT=Major
Sequence
MSASPTASMYSLSASTSTTTATTTLHPNNHLTLGDGSSSSSISSSGGGGGGVGARHSGSY
YTATSSPSQHPQNALLHPSGSGSGSVSGSSAAMQGLNAGSGVAHQQHQQQQQQQQQVNTA
SSPAFGFTLNASNSHHHHTTSATSMTSMMSSGSTHSSSGAVNGNTTSTAATATATASEAV
AATAALASTAGLPALEGRMHKWTNYLHGWQERYVQLSGGVLSYFKSQADVAYGCRGSMNL
REAVVLVHPYDELRFDVALQDSVYYLRTQSNDDRERWVEAIETSKTTLIETMSISSAGSV
RKKQSAKSLAFAASLKAKTLKERLSEMESYRDILGKQSDQLLLYYEQLLAYHQQLAMASV
SNVAQLSEGDGPLPPPPPPPIDENELREEVITYKATSSGMVTALDEVIQEVTKKDEEFAK
RYEHEVERRRQVEVELANLRSTKRPMPAIQNKLPGPDMEEGPHSSLKDDEFFDAVEASLD
KNDAFQMEDQTARQLAAGAHLAPLGKHRFADVVTKGLAEAKQFESEDVEHDKLWSVVLEE
NTTKVWRREIEDANGALLFDRLRAHCDIPGVSGREVADVFYDEEKRHKLEDAISEHQRTL
ELLDTNTYIQQVLYKKVWPAAQREAVCIVHLEQLGRFDWAACCWSVDHKDAPADKYCRVT
TSASLICRTRFHPSVDVSKITDLSAVPRDKISAHVMYTACVNPGGWAPITVVRAVAKREY
PKFLRRIEQIALSYVKPGSPLVH
Download sequence
Identical sequences XP_004344969.2.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]