SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004345306.1.32957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004345306.1.32957
Domain Number 1 Region: 82-118,150-253
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-27
Family RUN domain 0.00078
Further Details:      
 
Domain Number 2 Region: 1031-1145
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000525
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 1147-1295
Classification Level Classification E-value
Superfamily PH domain-like 0.0000063
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004345306.1.32957
Sequence length 1493
Comment hypothetical protein CAOG_06557 [Capsaspora owczarzaki ATCC 30864]; AA=GCF_000151315.2; RF=representative genome; TAX=595528; STAX=192875; NAME=Capsaspora owczarzaki ATCC 30864; strain=ATCC 30864; AL=Scaffold; RT=Major
Sequence
MAHMFEKMLRTTHSVNRAAERQLQHRPEKDKLIGTLQSITKDIQYKFIVAQQQQQQPKQE
AGTGTGTGTTTGTSSSSSSSAATGATALTGSSPEVVELCTAIEAVLRHGLKASHAGHSLA
SSVFHHNAAPQQSSGTTATTGAQALTIDPVRDEFWSYVATISRPEVVQMMTSKLVNVRTP
FGRGRAWVRLALNEKALESYFAIILNDTKARPKLYEDFAFIFDQELVLLLQTLISGLDLV
EFNIPYDINELDNPQYPAPRQPTTPQPQAQPNTPAPTLSPSSATGVPVMTAQAAVQQQQP
PLPASPAPGPPGSPLNLSGLVVSAPASDDALVVSHHVRKAKKPKADAPIADGSADNAAAI
AVAVKKKKKSVATISTPPATANVSSEPPLPAVAAASEAAPAPVATPAKPAAASVTPAPAP
APVTLPAVSALPVANATVPVAAPVPSNPPAPVLSSAAVPTAAPTPAIPRAAASTAAPSVS
APSTTAAPTAAQPVAAPTPAVITATKASKPAATKVAKDEVQIGSRWGAAPSVLSPTSEPS
TIDETLPAKSSIEARYHLPEESFTFEDLMNSPAVVSMKPDGATRGPAGTTGAGAAAATSS
SSSDAGALAQSAKIPTAADALIMPRTNIDAEAIRARAALDTAAPLPETDYMQVAQHLMHN
SSSPPPAEPLNGGAHDVSTSSTLSSVPASVASSYSSLVSDSIKSTTTESSNPSRSASAAP
TQPDVITSSTTASRTYLDIGADRARRAAQQAIVPVDNTVKLSLLLHVFQSDDEQVSFLTT
IRRVDNTNGKIEHTGFFLITTRAFYILNSLGGAPETASSMNMQTLGSEDGTLVDTAVEQS
YPVPELRRVVTGLNGQSVTLDFGGAAKPILLTRDEEAASLIVAQIKIIYAKRGIKTDPLP
AFTSDDSDHSSAIRAAVARKENDAGAIVRLYSLVHWRSVQGVKGDSASDTMSDRHPSGGA
LAEGEELDAAAAAAAAAASDSAATPGLNNERKVTSIALSLMLQGVDYMRPVKHKAGVLPH
SAGSSRLYAAKAGALNYRGHQFKMTHWKQNFFLLQEGVLYHYRSNTDPHPKLAMPVQASS
FHIRRIKESGQPFAFEVTCSQPLPIPGVEPPKSILGLSSAPEDRSFVVSATTEQQMDQWI
AALCLSHVEPLQRPGRHLFKEGSVRYKRVSLVPGASPSERTTLINSMASVKAIDAYLYLF
NDLLLVTTPTDIEGKFELLHAIPVSAVQPAHGGLLDQMQMHTLDQHPQPQLRKQLEATLK
NTCVFTLSSPIVTMELEAESIGDRQDWVQRITAKAESRRVVGNNGSGQKEGQGDTLFTSN
DSNMLDMLAMPFTKVFKSLEEIGGTVVTGVTALGALPAAMAKLSISSSIPVLGLSAAPVI
HTIAPTPPNGFAAAALLVSDRALHLCEENLRQNSVTVLATRGLDAITNLRIDAQYDPDMT
SYCTVMFDDIEHRDDKSWQLAFKTVSETDKFRAALESAWKALFGVELKVQVDM
Download sequence
Identical sequences A0A0D2X4K1
XP_004345306.1.32957 CAOG_06557T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]