SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004345727.1.32957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004345727.1.32957
Domain Number 1 Region: 1408-1461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 2 Region: 838-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.034
Further Details:      
 
Weak hits

Sequence:  XP_004345727.1.32957
Domain Number - Region: 587-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00243
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number - Region: 1150-1201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0155
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004345727.1.32957
Sequence length 2286
Comment hypothetical protein CAOG_06137 [Capsaspora owczarzaki ATCC 30864]; AA=GCF_000151315.2; RF=representative genome; TAX=595528; STAX=192875; NAME=Capsaspora owczarzaki ATCC 30864; strain=ATCC 30864; AL=Scaffold; RT=Major
Sequence
MNKTPRATLLLLLVLALISASAHGVSIVTGPSDKVVCAEQNVHLNLLVGETGGETNCCTA
TVERAIKNDDEWVAIPTVSATTTAVDASSSNVAIELAPSQVNDEFTYRITIETLDGATVT
SQEFFLAFSLPAVLQAPETNVAAQSAISVTAQLTPLRQEPELSVIRFTNSGPGFLQFRQS
SSSVSDFEYEVVDNVNADTMFEILPTLTLDTSTILLVDQADADHFLAWLDAFFAQSLQYL
SDPIGASSVAIALRDFNGLSFTSTSTWLGIYTAAQAQIHDAGAIADFEAEFGGRTFTLLF
SAPTKVDVVVRNSQGSYLGWMTSPQSLTALTQIDATQCAHKWFLDNSRLKASCSSTRALS
HLLTAPLLGTAILPTSQIAIISQYTTSSRTTSAITDSTYSIGSGATSSAVGVWSSRRCQQ
VGTSHLQSLLECAAQDDNPTYRQVHIELGAFGFGIKYVTVDLTHYPLPYPVDGPSAAILP
RQSGHSTSTKSRLELWVALAPSGTWIDVTDSVTEDFTRDCVSRGQRQRPCRVTFDVLEYL
RASDTILGNQAISDLRLVFDGIEPSSLDLDAAYRYFGISEVQAIGTCICNGHSSTCNYAT
GQCTGCEHHTQDDTCGSCDNTHWENRRNSLPAEVVNCDLAAPAVDNVLVCDGPALADIDV
SELESLFFESGGRSGVIVPGVSARDLPSAIFSKFFATGGACVLCNCHNHSLADAGQNVRG
CDASTGVCNCDPTTETTGDHCESCQATWCRSTSPCNNTPLSSSDLYACRLQSCSNERCDC
NGHSTLPQVGGFDQCDGNGCGCSCNPADGVTGPHCESCLPGHFSSTGDGVDGETCEPCFC
NGHKGSPETCDVSGGNCDQAGDPCQDNTTGFNCELCLDGFYRPFRPDGSIDPTDDCIPCA
CNGHGVGPALCNPNGGVCDCDPASNSEGDQCQSCIVGFWSATGNAESGTSCSACECNGHK
DYVSNECNALGGDCMTDFSGAPQPCDGNTNDFHCQGCVATFFRPCTVGVPTACSAVDYTD
DCSPCDCNGHSVSPIGGLDTCNAEGGLCTCTSSSNSEGDSCENCKPNTWNDFGNSEDGRD
CAPCACYGHSATCSNFGVCSGCQGNTEGNNCEQCVASNSRVNPAAFVGWDLPTPDPAVIT
TMREQDCTPCNCNGHSLNNPTIAPGICTPELGICLNCGGNTANGAANECDTCVPGFFRQL
TSAGFDPASDTCNACSLVDGDCTSDALTDACRPCSEQCFGANTMCGADTGICQECALSHA
ESHRCASCQNGYFGNPAGGIPCTPCKCYHSAPSKFDLLTETEIGTFQQCLFDNSLGGVSG
GAQTCIFDHSVNPDDAAADPQSAILCSCPRSIPGGFFNIISSGVVYEGRTCDSCNQDAYF
GQPTQCLTPGVGGSGLGDCLSFDTCNECICNGNIDESSMMDNCDYSAGNPSNLICEACLG
HSTGPNCEVCEVGYYGDPTRLDTPGTIGTGFILDASGESLKCFQCDCNGHSIARVVPGTE
GDVHNDTCTTVAPGFVGNYTCDCDSANGYTGPTCRECLLGYEQIALGGNLFRCDPCDNCT
RDAAAIIYGLIADYQHTMSLSQSVAASTAAIAAEITAIKDSLGLARRDADAVAGKAATII
AFLPTVQPLASDDKARSQQLNDLLEAFDDQTAQQATELTAQLAGLLEDASQVGNMLESPV
VDRLHDATSTLANLLARNTANRDQLVTLETSLESTMTAFASSSNWLSTHLQFAVDGREEL
DAAAEGLKYDRAEMEDSVAKPLNKLTLVWESVAAALEAQSSADLMALVERAGTDALRRLD
ALAARVSKLGSLTNQDKVLLSTNRDTLAELSARATLLEADLANKELEQSHAIIVIALGGI
DQAVRQFAEQAGLAEDHLMASLRDLDPAKAPHVTELVERISTDLEQHRTELVDSSAAMIQ
ELRAASAAAFATAQTNLATVQSQNARLMVLQSMLELIDKAAHKALSRVSDLLAGSRISTF
TAAVQAGTESALSPLERQTFNEHGNKLMATAATTLTLSREILDNFYERHRAMLVQFGAML
NANPVQVDRRQVQFDMSAFASVREELGQTAKVVAVESSDALHELQTAITSRAGALASMLQ
SVNVELSRTFSSIRAQTFKELTAISATVDSLPSAVAMVARGVEDELAAFADESERQFAVL
PDVEADAVALFVAAFRAEVGVIRERLTETNLLVSAIEQAIQVQADILDGAHRTSQATLQD
LRNMDANVREFLSLPPEASLTTLNSATGLRSFRMTASSASGRADLSAQSYIEFLRQTVSN
TQCILR
Download sequence
Identical sequences A0A0D2WTE7
CAOG_06137T0 XP_004345727.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]