SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004387572.1.4749 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004387572.1.4749
Domain Number 1 Region: 1200-1277
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 601-654
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 815-887
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000256
Family V set domains (antibody variable domain-like) 0.086
Further Details:      
 
Domain Number 4 Region: 1099-1177
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000232
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 313-373
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 465-519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000746
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 368-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 710-775
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 9 Region: 654-714
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 1317-1374
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0071
Further Details:      
 
Domain Number 11 Region: 1368-1435
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000536
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 12 Region: 235-295
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 13 Region: 1499-1554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 14 Region: 543-598
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000602
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004387572.1.4749
Sequence length 1581
Comment PREDICTED: ADAMTS-like protein 3, partial [Trichechus manatus latirostris]; AA=GCF_000243295.1; RF=representative genome; TAX=127582; STAX=9778; NAME=Trichechus manatus latirostris; AL=Scaffold; RT=Major
Sequence
NCEGQNIRYKTCSNNDCPPDAEDFRAQQCSAYNDVQYQGRYYEWLPRYNDSTAPCALKCH
ARGQNLVVELAPKVLDGTRCNADSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGST
CRLVRGQSKSHVSPEKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSP
GVFVVENTTVEFLRGSERQTFKIAGPLMADFIFKTRYTVAKDSMVQFFFYQPISHQWRQT
DFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDG
FKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAP
KPKVMQTCNLFDCPKWIAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQLKLHIKE
ECIIPIPCYKPKEKSPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQV
REVKCLVLLTFTQAETELPEEECEGPKLPTERPCLLEACEESLASLELDASVQEKDSEMT
YDWEYAGFTPCTATCLGGRQEAIAVCLHIQTQQTVNDTLCNAVHRPPAMSQACNMEPCPP
RWHMGSWGPCSATCGVGIQTRDVYCLHPGESLAPPEECRAEKPHALQACNQFDCPPGWHI
EEWQQCSRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHFTV
GDWSQCSVSCGVGIQRRKQVCQRLTAKGRRVPLGEVMCRDLPGPPLVRSCQMPACNKMKT
KLGEQGPLILGVQRVYIQTREEKRVNLTIGGRAYLLPNTSVIIKCPVRRFQKSMIQWEKD
GHCLQNSKRLGITKSGSLKIHSLAAPDIGVYRCIAGTAQETGVLKLIGTDNRLIAPPALR
EHRRGYPGIDHNQDNSLGAMWHKMRQMWSNKKELYLDDGEINNQPLLRALLGHCSNSAGN
TNSWELKNKQFEAAVKQGAYSMDTAQFEELIRNMSQLMETGEVSDDLASQVIYQLVAELA
KAQPAHMQWRGIQEEVPPAAQLRGDTGSVPQNSNAKNSGKLTFKPKAPVLVRQSQPSAIS
FNKTINSRIGNTVYITKRTEVINILCDLVTPSEATYTWTKDGTLLQLSAKVILDGTGKIQ
IRNPTRKEQGVYGCSVANHLGSDMESSSVLYAEAPVILSVERNITKPEHNHLSAVVGGII
EATLQANVTIRCPVKGVPQPNVTWLKRGGSLSDNISLLFNGSLLLQNISLENEGTYVCTA
TNALGKAMATSVLHLLERRLPDSIIVFPKGHKKHVLLASNTGPNIDDTPGEALPQVPFWE
PGNWTHCSATCGHLGTSVQRPQCVMANGQEVSEALCDPLQKPLAGFQPCNIRDCPARWLT
SAWSECSVSCGEGFCSRQVTCTRTKANGTVQVLSPRACATKDRPLGRKPCSSHPCVQWAI
EPGNQCPGHCMRRAVRMQQQRHPLCQQHNGSATPDSQCDDRRRPPTFRRNCSSGACDVCW
RTGPWRPCTAACGMGFQARKVDCVHKTSCKPVAERHCGQQKKPTSWRRCLGPSCDSTYLS
QTSTNKSAASHVKKDKRLAGS
Download sequence
Identical sequences XP_004387572.1.4749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]