SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004395661.1.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004395661.1.74151
Domain Number 1 Region: 145-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-99
Family Protein kinases, catalytic subunit 0.0000000000539
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-24
Family Pleckstrin-homology domain (PH domain) 0.000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004395661.1.74151
Sequence length 480
Comment PREDICTED: RAC-alpha serine/threonine-protein kinase isoform X1 [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEELRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDNMEGEDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences E2RJX4
ENSCAFP00000027133 XP_004395661.1.74151 XP_005623933.1.84170 XP_013971651.1.84170 XP_021535559.1.83697 ENSCAFP00000027133 9615.ENSCAFP00000027133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]