SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004409224.2.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004409224.2.74151
Domain Number 1 Region: 230-655
Classification Level Classification E-value
Superfamily Sema domain 5.89e-99
Family Sema domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1553-1679,1876-2027
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.69e-39
Family p120GAP domain-like 0.035
Further Details:      
 
Domain Number 3 Region: 1107-1196
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000331
Family Other IPT/TIG domains 0.038
Further Details:      
 
Domain Number 4 Region: 1015-1110
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000267
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 5 Region: 658-710
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000436
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1195-1239,1277-1330
Classification Level Classification E-value
Superfamily E set domains 0.000000318
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004409224.2.74151
Sequence length 2095
Comment PREDICTED: plexin-B3 [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
MGGHSPGSHLLQPGAHGQPSAVPTMAGRGQQRPALHHQPPNRPSQVAVSPTGCHLALEPG
ACRWSLLLPCTMEKARRGALGPSRDGVSLGEGEGNSRQPVALPEAKCWVPGGHGPHPVLC
IPQQRPPLAPPTTIRLYLARLYESPEAGLDGDRPPSLNRVPPAQDNAPHSRLVPITTALG
RLNGCRTAQETPPLLPSEAVPVMAAWRPFSPRLLPVLLLYLPLPLTRARPFSAPNTTFNH
LALAPGRGTLYVGAVNRLFQLSPELQLEAVAVTGPVFDSPDCVPFRDPADCPQARLTDNT
NQLLLVSSRAQELVACGQARQGVCEKRGLEDVARVLYQAEDPGDGQFVAANAPGVATVGL
VVQAPGRDLLLVARGLAGKLSGGVPPLTVRQLAGPQPFSSEGLGRLVVGDFSDYNNSYVG
AFANARSAYFVFRRRGARAQAEYRSYVARVCLGDANLYSYVEVPLTCRGQGLIQAAFLTP
STLLAAFAAGPGGTRAALCAFPLAELDGSMERARRLCYTAGGRGPSGLEEATVEYGVTSR
CVALPADSPESYPCGDEHTPSPIAGRQPLEAKPVLQLGQPISAVAGLQADGHTIAFLGDT
QGQLHKVFLNGSQGQVYHSQQVGPLGSAISPDLLVDSSGSHLYVLTAQQVDRVPVAACPQ
FPDCTSCLQARDPLCGWCVLQGRCTRKGQCGRAAQANQWLWSYEDSHCPHVQSLLPAQRP
RQEPGQVTLSVPRLPTLAMDEYFHCAFGDYDSLAHVEGPHIACVTPPQDQLPLNPPGTDH
ITLPLALMFEDVAVAATNFSFYDCSAVQALEVAAPCRACVGSLWPCHWCPQSSRCVYGEH
CPEGEGTVYSAQEVDVQVRGPGACPRVEGLAGPLLVPVGWESRLALRVRNLQHFGSLPAS
YHCWLELPGELRRLPASLEEMAGDVGLIYCQAQEFRPSTAQRELPVPIYVTRGKGQRLDN
AHTLHVTLYDCAVGHPDCSRCQAANGSLGCVWCSHGQPTCRYGPLCPPGAVELLCPTPSI
DTIEPLTGPPEGGLALTIWGTNLGRDFAEVQDAVKVAGRPCSPEPSLYRTSARIVCVTSP
APNGTTGPIQVAIKNRPPGISTQHFTYQDPILLSLSPRWGPQAGGTRLTIHGQHLQTGGN
IKAFVGGQPCPIREPVCPEAIVCHTMSQASPGEAVVQVVFGHAQRTLLTSPFQYTANPQL
VAAEPSVSFRGGGRLIRVRGTGLDVAERPLLSVWLEAKAEVQAAGAQPQDPTLRRSCGAP
AAAPQACIQLEGGLLQCSTVCSVNSSSLLLCQSPAVPDGAHPRRVFFSLDGVHVDFASAS
GGQDFLYQPNPRLAPLSREEPTRPYRLKPGNVLDVEGQGLNLGISKEEVRVHIGDGECLV
KTLTLTHLYCEPPSRAPQPANGSGTLPQFVVQMGNVRLALGPVQYETEPALSAFPVEAQV
GLGVGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLENLEIGVGDQCRKEFTDLMTEM
TDLSSDLEASGIPFLDYHTYAERVFFPGHGGGPRQPALEGSGEEGRRGPVRQGLTQLSNL
LNSKLFLLTLIHTLEEQPGFSQRDRCHVASLLSLALHGKLEYLTDIMRTLLSDLAAHYVH
KNPKLMLRRTETMVEKLLTNWLSICLYAFLKEVAGEPLYMLLRAIQYQVDKGPVDAVTGK
AKRTLNDSRLLREDVEFRPLTLMVLVGPRAGGAAGSSAAQRVPARVLDTDTITQVKEKVL
DQVYKGTPFSQRPSVHTLDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGA
TVGLIPQLHNGGAVSQSLAQNCPLGENIPMLEDAEEGGVRLWHLVKASDEPEGAKVRRSS
LRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPVPIAVKYLFDFLDE
LAEKHGIEDPETLHIWKTNSLLLRFWVNALKNPRLIFDVRVSDNVDAILAVIAQTFIDSC
TVSEHKVGRDSPVNKLLYAREIPRYKQMVERYYSDIRQSSPASYQEMNSALAELSGNYTS
APHCLEALQELYNHIHRYYDQIISALEEDPVGQKMQLACRLQQVAALVENKVTDL
Download sequence
Identical sequences XP_004409224.2.74151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]