SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004411535.1.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004411535.1.74151
Domain Number 1 Region: 2209-2302
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-32
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 509-647
Classification Level Classification E-value
Superfamily FAS1 domain 6.93e-30
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1473-1521,1599-1713
Classification Level Classification E-value
Superfamily FAS1 domain 5.89e-29
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1713-1868
Classification Level Classification E-value
Superfamily FAS1 domain 1.03e-25
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 965-1122
Classification Level Classification E-value
Superfamily FAS1 domain 5.23e-24
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 386-501
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-20
Family FAS1 domain 0.0048
Further Details:      
 
Domain Number 7 Region: 2300-2462
Classification Level Classification E-value
Superfamily FAS1 domain 1.01e-16
Family FAS1 domain 0.0086
Further Details:      
 
Domain Number 8 Region: 1130-1254
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000012
Family FAS1 domain 0.0087
Further Details:      
 
Domain Number 9 Region: 1545-1582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family Merozoite surface protein 1 (MSP-1) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004411535.1.74151
Sequence length 2572
Comment PREDICTED: stabilin-1 [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
MAGPRGRLLLCLLAFCLAGSSFTRGQKVRSRRCDVKTKFVTRIPCTMCPAIKRRMCPPGW
LRELPEKISQDCRYEVQLGDSLMSMSGCSLECWKDVVEKACCPGYWGSQCYECPGGAETP
CNGHGTCLDGISRNGTCVCQEHFGGSACQECQDPNRFGPNCQSVCSCVHGVCSHGPLGDG
SCLCFAGYTGPRCDQELPVCRALNCPQNSQCSAEAPGCSCLPGHTQQGRECRAPNPCQSS
PCSPLAQCSVSPTGQAQCRCPKDYHGDGTVCLPQDPCTINYGGCPSNSTLCLYQRPGKAS
CLCKPGLVSINHNTSAGCFAYCFPHSCDRSATCQVTPDGKISCVCKEGEIGDGRACYGHL
LHEIQKAGQLGVVFLRLRVSLAMLDQGCREILTTAGPFTVLVPSLSSVSSRTMNASLARQ
LCKQHIIAGQHMLEEPGTQQTRRWWTLAGQEITVTFNRFTKYTYKYKEYPQQTFTIHKTN
HPAANGVFHLVTALQWQPPPELPEDPKRTIGQILASTEAFSRFETILENCGLPSILDGPG
PFTVFAPSNEAVDKLRDGRLIYLFTAGLSKLQELVKYHIYSHGQLTIEKLISKGRVLTMA
NQVLAVNISEEGRILLGPEGLPLRRVDVLASNGVIHMLEGVLLPPTILPILPKHCSEEQH
QIVAGSCVDCQALNTSTCPSNSVKLDIFPKECVYTHDPTGLNVLKKGCAHYCNQTVLKPG
CCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVRGNGACLCFPDYKGIACHICSNPNKHGDR
CQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESAGNCGPTEQAQRCHLHARCVS
QGGVTRCVCLDGFEGDGLSCVPGNPCSHPDRGGCSENAECVPGARGTHHCTCHKGWSGDG
RVCVAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRAGNGGCH
DLATCRAVGGGQRVCTCPSGYGGDGFSCYGDIFRELEANAHFSVFYQWIKSAGLTLPTDS
RVTALVPSESAIRRLSPEDQAFWLQPRALRQLVRAHFLQGALSEEELTRLGGQDVATLSP
TTRWEIHNISGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGHVLPGEGLLQQLDLVP
AFRLFRELLQHHKLVPQIEAATAYTIFVPTNRSLEARGNSSRLDADTVRHHVILGEALSV
EALQRGGHRNSLLGPAHWLVFYNHSGQPEVNHVLLEGPVLEAPGCSLFGLSGVLTVGSSR
CLHSHAESLREKCVNCSRRFRCTQGFQLENTPKKSCVYRSGSSFSRGCSYTCAKRIQVPD
CCPGFFGTLCEPCPGGQGGVCSGHGQCQDRLLGTGECRCHEGFHGTACEMCELGRYGPSC
AGVCDCAHGLCQEGLQGDGSCVCNVGWQGPRCDQKISGPQCPKKCDPNANCLQDSAAAPA
CVCAAGYSGDGIYCSEVDPCAQDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEVN
GCLIRHGGCHMHADCIPTGPQQVSCSCREGYSGDGIWTCVLLDPCSQNNGGCSPYAVCKS
TGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGEGPFTVFVP
RADLMTNLSQDELARIRAHRQLVFRYHVVGCRQLSSQELLEEGYVTTLSGHPLRIHEREG
SIYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLHWEPDAAPVLRRNVTAAAEGFGYKI
FSGLVKVAGLLPLLQDASHRPLTMLWPTDSALQALPPDRQTWLYHEDHRDKLAAILRGHV
IRNIEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEEDARIVQRHLPFEGGLAYG
IDQLLEPPGLGARCDHFETRPLRLKICSICGLEPPCPEGSQEQGSPEACWRYYSKFWTSP
PLQSLALRSIWARSSLWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASSPC
SGHGVCVDGMSGSGQCQCHARFTGTVCELCAPGAFGPQCQACRCSSHGRCDEGLGGSGSC
FCDEGWTGPSCEVQLELQPACAPPCAPQAVCRADSSCECGLGYEGDGHTCTVADLCRDGH
GGCSEHANCSQVGTVVTCACLPAYEGDGWSCRARDPCADGRRGGCSEHADCLSTGPNTRR
CVCHAGYVGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCTDLHFQEKQAGVFHLQAPSGPY
SLNFSEAEAACGAQGAVLASLPQLSAAQKLGFHLCLVGWLANGSAAHPVVFPAADCGGGQ
VGVVSLGTRKNSSERWDAYCYRELDVACRCRRGFVGDGTSVCNGKLLDVLAATANFSTFY
GMLLGYANATPQGLDFLDFLDDELTYKTLFVPVNEGFLDNMTLSGPDLELHASNTTFLSA
NASQDAVLPAHSGLSLVFSAADPDNSSWAPVAPGAVVLSRVIVWDIMAFNGIIHALARPL
LAPLQPQAVVAAEAPPVAAGVGAVVAAGALLSLVAGAFYLRARGKATGFGFSTFQAEDDA
EEDFSPWQEGTSPTLVSVPNPVFGSHDAFCEPFDDSLLEDNFPDTQRILAVK
Download sequence
Identical sequences XP_004411535.1.74151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]