SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004415567.1.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004415567.1.74151
Domain Number 1 Region: 245-315
Classification Level Classification E-value
Superfamily Homeodomain-like 2.05e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 88-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000346
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 56-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000291
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  XP_004415567.1.74151
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00294
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004415567.1.74151
Sequence length 388
Comment PREDICTED: LIM/homeobox protein Lhx9 isoform X2 [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
MLNGTTLEAAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPA
LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFS
VQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFET
LLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNEN
EADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKR
VLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPT
ITVVTSVTSNMDSHESGSPSQTTLTNLF
Download sequence
Identical sequences A0A096NXJ4 A0A2I2YZK2 A0A2K5JX07 A0A2K5LNX9 A0A2K5TRR7 A0A2K6A315 A0A2K6E6H0 A0A2K6MTM4 A0A2K6R1B3 F6V031 H0XSA3 H2N4A3 H2Q0U6
ENSPPYP00000000434 ENSPPYP00000000434 9598.ENSPTRP00000003025 9600.ENSPPYP00000000434 NP_001014434.1.87134 NP_001014434.1.92137 XP_004415567.1.74151 XP_004685539.1.23501 XP_006749104.1.47382 XP_007987242.1.81039 XP_007987243.1.81039 XP_008974914.1.60992 XP_009237926.1.23681 XP_010356547.1.97406 XP_011744814.1.29376 XP_011787079.1.43180 XP_011825638.1.47321 XP_011891812.1.92194 XP_012662090.1.62490 XP_017751939.1.44346 XP_018893192.1.27298 XP_021538168.1.83697 gi|62241033|ref|NP_001014434.1| ENSOGAP00000018995 ENSP00000356360 ENSP00000356360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]