SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004416616.2.74151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004416616.2.74151
Domain Number 1 Region: 1026-1104
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 642-716
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000246
Family I set domains 0.057
Further Details:      
 
Domain Number 3 Region: 926-1003
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000337
Family I set domains 0.031
Further Details:      
 
Domain Number 4 Region: 425-478
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000445
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 138-198
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 193-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 290-344
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 8 Region: 1196-1263
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 9 Region: 534-599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000103
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 1144-1202
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 11 Region: 478-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 60-120
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 13 Region: 365-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000719
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 
Domain Number 14 Region: 1322-1377
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004416616.2.74151
Sequence length 1432
Comment PREDICTED: ADAMTS-like protein 3, partial [Odobenus rosmarus divergens]; AA=GCF_000321225.1; RF=representative genome; TAX=9708; STAX=9707; NAME=Odobenus rosmarus divergens; AL=Scaffold; RT=Major
Sequence
CCDRYVIVCITEIDSSHLERCGKCWLLVCRHVIAVLSVQTRYTVAKDSVVQFFFYQPISH
QWRQTDFFPCTVTCGGGYQLNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPC
PSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWK
CMYAPKPKVMQTCNLFDCPKWIAMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQLK
LHIKEECIIPIPCYKPKEKSPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCG
PGVQVREVKCRVLLTFTQTETELPEEECEGPELPTERPCLLKPCSEGPASRELDVSLQED
SRMIYHWEYAGFTPCTATCLGGHQEAIAVCLHTQTQQTVSDTLCDMVHRPPAMSQSCNTE
PCPPRWHTGSWGPCSATCGVGIQTREVYCLHPGESPAPTEECGDEKPHALQACNQFDCPP
SWHIEEWQQCSRTCGGGTHNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPP
HVTVGDWSKCSVSCGVGTQRRKQVCQRLTAKGQRVPLSEMMCRDLPGPPLVRSCQMPACD
KIKPEPKTKPGEQGPQILGVQRVYIQTREEKRINLTVGSRAYLLPNTSVIIKCPVRRFQK
SLIQWEKDGHCLQNSKRLGITKSGSLKIHSLAAPDIGTYRCVAGSAQETAVLKLIGTDNR
LIAPPVLGEHVREYPGMDPKEANSLGATWQKMRQLWGNKNELYPEDGQIAEQPFLRALLG
PCRNSAGSTNSWELKNKQFEAAVKHGAYSMDMAQFDELIRNMSQLMETGEVSDDLASQVI
YQLVAELAKVRPAREPWRGVQEGVPPTAQLRGGTRRVPQVSGMENSGKLTFKPKGPVLMR
QSQPTSISFNKTINSRIGNTVYITERTEVINILCELVTPSQATYTWTKDGALLQPSEKII
LAGMGKMQIRNPTKKEQGTYGCSVANHLGSDVESSSVLYAEAPAILSIERNISRLEHSHL
SVVVGGVVEAALQADVTIRCPVKGVPQPNITWLKRGGSLSDNVSLLFNGSLLLQNVSLEH
EGTYVCTASNALGKAVATSVLHLLEQRRLDSKSVFPKDYKNHMLQASNAGTNSNDPTGEP
RPPEPFWELGNWTHCSATCGHLGARVQRPRCVMANGQEVSEALCQNLPKPLAGFQPCNIR
DCPSRWFTSAWSECSVSCGEGFHSRQVTCKRAKANGTMQVMSPRACAPRERPPGRRPCSS
HPCGQWVVEPGGQCPARCLGRTGRMQLQHAVCQHHNSSDPRCDDRRRPALRRNCSSGACD
TCWRTGPWRPCTAACGRGFQSRKVDCVRTRSCRPVVERHCVQKKKPASWRHCLGPSCDST
YPSQISTNRGAASLVKKGKPVAGGRNAAVKTEPKRIEALFPHVAGSETCDFS
Download sequence
Identical sequences XP_004416616.2.74151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]