SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004436645.1.5094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004436645.1.5094
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-45
Family Calponin-homology domain, CH-domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_004436645.1.5094
Sequence length 199
Comment PREDICTED: transgelin-3 [Ceratotherium simum simum]; AA=GCF_000283155.1; RF=representative genome; TAX=73337; STAX=9807; NAME=Ceratotherium simum simum; AL=Scaffold; RT=Major
Sequence
MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGT
VLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQAGMTGYGMPRQIM
Download sequence
Identical sequences Q9R1Q8
ENSMUSP00000093762 ENSMUSP00000093762 10090.ENSMUSP00000093762 ENSMUSP00000093762 NP_062728.1.92730 XP_003497895.1.69978 XP_004436645.1.5094 XP_004436646.1.5094 XP_006975849.1.50099 XP_007619515.1.28591 XP_013207207.1.66349 XP_021519744.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]