SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004451720.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004451720.1.11602
Domain Number 1 Region: 647-842
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000436
Further Details:      
 
Domain Number 2 Region: 464-575
Classification Level Classification E-value
Superfamily PH domain-like 5.28e-19
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 3 Region: 9-83
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000016
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 257-296
Classification Level Classification E-value
Superfamily WW domain 0.00000000935
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 361-389
Classification Level Classification E-value
Superfamily WW domain 0.000026
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_004451720.1.11602
Sequence length 844
Comment PREDICTED: rho GTPase-activating protein 12 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MADRSGKIVPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPNENSKAF
YVPAQYVKEVTRKALMPPVKQAVGLPNNSVKMIQSLHLQKSTENVNKLPELSSFGKSSSS
VQGTGLIRDANQNFGSSCSSAQTLSLNLDLTHNNGKFNSDSHSPKVPSQNRTRLFGHIPG
PEFLDIEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDSPV
YANLQELKISQSALPPLPGSPAIQVNGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRDA
TISKGDFQSPGDQELLSSEENYPSICYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNE
KWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRH
STIVLDTNDKESPTASKPCFPENESSPSSPKHQDTASSPKGQEKYGLLNVTKITENGKKV
RKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKKNV
LELKTRQGTELLIQSDNDTVINDWFKVINSTINNQAVETDEVIEEEIPDSPGIEKHDKEK
DHKDPKKLRSIKVASIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLANLC
QRENGTVPKFVKLCIEHVEEYGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDGKWED
IHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDTMQI
LFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLELSS
IFGR
Download sequence
Identical sequences XP_004451720.1.11602 ENSDNOP00000028764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]