SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004452526.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004452526.1.11602
Domain Number 1 Region: 563-578,613-993
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.32e-103
Family Formin homology 2 domain (FH2 domain) 0.00000261
Further Details:      
 
Domain Number 2 Region: 53-417
Classification Level Classification E-value
Superfamily ARM repeat 3.23e-101
Family Diap1 N-terninal region-like 0.0000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004452526.1.11602
Sequence length 1068
Comment PREDICTED: disheveled-associated activator of morphogenesis 1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MAPRKRSGRGISFIFCCFRNNDHPEITYRLRNDSSFALQTMEPALPMPPVEELDVMFSEL
VDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLL
ALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKV
LQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVNLKTAIMSFINAVLSQGAGVESLDF
RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEK
EEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELNRRAVCASVPGGPSPGAPGGPF
PSSGPGCLLPLPPPLPLQGGMLPPPPPPLPPGGPPPPPGPPPLGGIMPPPGAPLGLALKK
KNIPQPTNALKSFNWSKLPENKLEGTVWTEIDDAKVFKILDLEDLERTFSAYQRQQKEAD
AIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQ
LLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEV
KPKVEAIRSGSEEVFRSNALRQLLEVVLAFGNYMNKGQRGNAYGFKISSLNKIADTKSSI
DKNITLLHYLITIVERKYPKVLSLNEELQDIPQAAKVNMTELDKEISTLRSGLKAVETEL
EYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPD
EFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEES
GEFDDLVSALRSGEVFDKDLSKLKRNRKRITNQITDSSRERPVTKLNF
Download sequence
Identical sequences ENSDNOP00000002766 XP_004452525.1.11602 XP_004452526.1.11602 XP_004452527.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]