SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_004452677.1.11602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_004452677.1.11602
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.95e-76
Family BAR domain 0.0059
Further Details:      
 
Domain Number 2 Region: 392-571
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000182
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 665-685,759-814
Classification Level Classification E-value
Superfamily SH3-domain 1.42e-16
Family SH3-domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_004452677.1.11602
Sequence length 815
Comment PREDICTED: rho GTPase-activating protein 26 isoform X1 [Dasypus novemcinctus]; AA=GCF_000208655.1; RF=representative genome; TAX=9361; STAX=9361; NAME=Dasypus novemcinctus; AL=Scaffold; RT=Major
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKMQLTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVTLKSCIRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVSSRV
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLE
NQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDPPITNAQLHLSRKKSSDSKPPSCSERP
LTLFHAVQSTEKQEQRNSIITSSLESVVSSNANSILNSSSSLQPNMNSSDPDLDVVKPTR
PNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFSVAAVVLSFAW
SSLHAVFSLLVNFVPCHPTLNLLFDRPEEEVHEDSSTPFRKAKALYACKAEHDSELSFTA
GTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Download sequence
Identical sequences XP_004452677.1.11602 ENSDNOP00000000445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]